PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_F1DE20B4B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 339aa    MW: 36768.4 Da    PI: 9.0015
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_F1DE20B4B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.72.9e-31174230158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  Traes_5BS_F1DE20B4B.1 174 DAPIYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 230
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.8E-35172233IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.01173233IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.7E-28176230IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.3E-23176198IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860178198IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.3E-23207230IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MMSFKNHHEG FAGQQLLAAA AAAASQVSGG APLPWWVGSQ LLYGEPMGHG KAPPAVPMSM  60
SPPEDACRDG QFQVVPRAQA LLDAVPLPMG ERGIPEALKF SMAHGKGGNS SEHSAPITLQ  120
SPFTEYNDHF ELGLGQSVIS SNYYSDQQYG LLSSYGMRSA SSGRMLIPLN MPADAPIYVN  180
AKQYEGILRR RRARAKAEKE NRLVKARKPY LHESRHLHAM RRARGSGGRF LNTKKETNGK  240
DTGVGSKAMA GNPLMRPAAS LSSEIQHSEQ GNRSSVSSLS GSEVTSLYDH EDVDHYHNFE  300
HLRTHFFTPL PSIMDGEHGA GNPFKWAAAS DGCCNLLKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-17174238266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787570.0KM078757.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-B6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577268.11e-156PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-156PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_014757443.11e-156PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLW5FPG70.0W5FPG7_WHEAT; Uncharacterized protein
STRINGMLOC_76757.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.11e-28nuclear factor Y, subunit A2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]